SCOPe 2.08: Domain d2yznb1: 2yzn B:1-114

Lineage for d2yznb1 (2yzn B:1-114)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225372] (3 PDB entries)

8. Domain d2yznb1: 2yzn B:1-114 [207757]
   Other proteins in same PDB: d2yzna2, d2yznb2, d2yznc2
   automated match to d1e4ea1
   complexed with anp

Details for d2yznb1

PDB Entry: 2yzn, 2.6 Å

PDB Description: Crystal structure of D-alanine:D-Alanine Ligase with AMPPNP from Thermus thermophilus HB8.

PDB Compounds: (B:) D-alanine-D-alanine ligase

SCOPe Domain Sequences for d2yznb1:

Sequence; same for both SEQRES and ATOM records:

>d2yznb1 c.30.1.0 (B:1-114) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm

Timeline for d2yznb1:

• d2yznb1 first appeared in SCOPe 2.03
  
• d2yznb1 appears in SCOPe 2.07