| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
| Protein automated matches [226903] (40 species) not a true protein |
| Species Thermus thermophilus HB8 [TaxId:300852] [225372] (3 PDB entries) |
| Domain d2yznb1: 2yzn B:1-114 [207757] Other proteins in same PDB: d2yzna2, d2yznb2, d2yznc2 automated match to d1e4ea1 complexed with anp |
PDB Entry: 2yzn (more details), 2.6 Å
SCOPe Domain Sequences for d2yznb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yznb1 c.30.1.0 (B:1-114) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm
Timeline for d2yznb1:
View in 3DDomains from other chains: (mouse over for more information) d2yzna1, d2yzna2, d2yznc1, d2yznc2 |