Lineage for d2yzna2 (2yzn A:115-319)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979216Species Thermus thermophilus HB8 [TaxId:300852] [225373] (3 PDB entries)
  8. 2979220Domain d2yzna2: 2yzn A:115-319 [207756]
    Other proteins in same PDB: d2yzna1, d2yznb1, d2yznc1
    automated match to d1e4ea2
    complexed with anp

Details for d2yzna2

PDB Entry: 2yzn (more details), 2.6 Å

PDB Description: Crystal structure of D-alanine:D-Alanine Ligase with AMPPNP from Thermus thermophilus HB8.
PDB Compounds: (A:) D-alanine-D-alanine ligase

SCOPe Domain Sequences for d2yzna2:

Sequence, based on SEQRES records: (download)

>d2yzna2 d.142.1.0 (A:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

Sequence, based on observed residues (ATOM records): (download)

>d2yzna2 d.142.1.0 (A:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantsvgisrverfqdleaal
alafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgrael
lipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyp
rlfeaggvaypellrrlvelalt

SCOPe Domain Coordinates for d2yzna2:

Click to download the PDB-style file with coordinates for d2yzna2.
(The format of our PDB-style files is described here.)

Timeline for d2yzna2: