SCOPe 2.03: Domain d2yzma1: 2yzm A:1-114

Lineage for d2yzma1 (2yzm A:1-114)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (9 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (19 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:300852] [225372] (3 PDB entries)

8. Domain d2yzma1: 2yzm A:1-114 [207749]
   Other proteins in same PDB: d2yzma2, d2yzmb2, d2yzmc2
   automated match to d1e4ea1
   complexed with dal

Details for d2yzma1

PDB Entry: 2yzm, 2.21 Å

PDB Description: structure of d-alanine:d-alanine ligase with substrate from thermus thermophilus hb8

PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2yzma1:

Sequence; same for both SEQRES and ATOM records:

>d2yzma1 c.30.1.0 (A:1-114) automated matches {Thermus thermophilus [TaxId: 300852]}
mrvlliaggvspehevsllsaegvlrhipfptdlaviaqdgrwllgekaltaleakaape
gehpfppplswerydvvfpllhgrfgedgtvqgflellgkpyvgagvaasalcm

Timeline for d2yzma1:

• d2yzma1 is new in SCOPe 2.03-stable
  
• d2yzma1 appears in SCOPe 2.04
  
• d2yzma1 appears in the current release, SCOPe 2.08