SCOPe 2.08: Domain d2yzgc2: 2yzg C:115-319

Lineage for d2yzgc2 (2yzg C:115-319)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (39 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225373] (3 PDB entries)

8. Domain d2yzgc2: 2yzg C:115-319 [207748]
   Other proteins in same PDB: d2yzga1, d2yzgb1, d2yzgc1
   automated match to d1e4ea2

Details for d2yzgc2

PDB Entry: 2yzg, 2.3 Å

PDB Description: crystal structure of d-ala:d-ala ligase from thermus thermophilus hb8

PDB Compounds: (C:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2yzgc2:

Sequence, based on SEQRES records:

>d2yzgc2 d.142.1.0 (C:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

Sequence, based on observed residues (ATOM records):

>d2yzgc2 d.142.1.0 (C:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapgraellipapldp
gtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeaggv
aypellrrlvelalt

Timeline for d2yzgc2:

• d2yzgc2 first appeared in SCOPe 2.03
  
• d2yzgc2 appears in SCOPe 2.07