Lineage for d2yzgb2 (2yzg B:115-319)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979216Species Thermus thermophilus HB8 [TaxId:300852] [225373] (3 PDB entries)
  8. 2979218Domain d2yzgb2: 2yzg B:115-319 [207746]
    Other proteins in same PDB: d2yzga1, d2yzgb1, d2yzgc1
    automated match to d1e4ea2

Details for d2yzgb2

PDB Entry: 2yzg (more details), 2.3 Å

PDB Description: crystal structure of d-ala:d-ala ligase from thermus thermophilus hb8
PDB Compounds: (B:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d2yzgb2:

Sequence, based on SEQRES records: (download)

>d2yzgb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfydyetkytpgra
ellipapldpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsm
yprlfeaggvaypellrrlvelalt

Sequence, based on observed residues (ATOM records): (download)

>d2yzgb2 d.142.1.0 (B:115-319) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
dkdlskrvlaqagvpvvpwvavrkgeppvvpfdppffvkpantgssvgisrverfqdlea
alalafrydekavvekalspvrelevgvlgnvfgeaspvgevryeapfpgraellipapl
dpgtqetvqelalkaykvlgvrgmarvdfflaegelylnelntipgftptsmyprlfeag
gvaypellrrlvelalt

SCOPe Domain Coordinates for d2yzgb2:

Click to download the PDB-style file with coordinates for d2yzgb2.
(The format of our PDB-style files is described here.)

Timeline for d2yzgb2: