SCOPe 2.06: Domain d2yz1b_: 2yz1 B:

Lineage for d2yz1b_ (2yz1 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d2yz1b_: 2yz1 B: [207742]
   automated match to d1xiwc_

Details for d2yz1b_

PDB Entry: 2yz1, 1.4 Å

PDB Description: Crystal structure of the ligand-binding domain of murine SHPS-1/SIRP alpha

PDB Compounds: (B:) tyrosine-protein phosphatase non-receptor type substrate 1

SCOPe Domain Sequences for d2yz1b_:

Sequence; same for both SEQRES and ATOM records:

>d2yz1b_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elkvtqpeksvsvaagdstvlnctltsllpvgpikwyrgvgqsrlliysftgehfprvtn
vsdatkrnnmdfsirisnvtpedagtyycvkfqkgpsepdteiqsgggtevyvl

Timeline for d2yz1b_:

• d2yz1b_ first appeared in SCOPe 2.03
  
• d2yz1b_ appears in SCOPe 2.05
  
• d2yz1b_ appears in SCOPe 2.07
  
• d2yz1b_ appears in the current release, SCOPe 2.08