Lineage for d2yz1a_ (2yz1 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759483Domain d2yz1a_: 2yz1 A: [207741]
    automated match to d1xiwc_

Details for d2yz1a_

PDB Entry: 2yz1 (more details), 1.4 Å

PDB Description: Crystal structure of the ligand-binding domain of murine SHPS-1/SIRP alpha
PDB Compounds: (A:) tyrosine-protein phosphatase non-receptor type substrate 1

SCOPe Domain Sequences for d2yz1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yz1a_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elkvtqpeksvsvaagdstvlnctltsllpvgpikwyrgvgqsrlliysftgehfprvtn
vsdatkrnnmdfsirisnvtpedagtyycvkfqkgpsepdteiqsgggtevyvl

SCOPe Domain Coordinates for d2yz1a_:

Click to download the PDB-style file with coordinates for d2yz1a_.
(The format of our PDB-style files is described here.)

Timeline for d2yz1a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yz1b_