Lineage for d2yy9a_ (2yy9 A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1411215Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1411216Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1411380Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1411381Protein automated matches [190710] (3 species)
    not a true protein
  7. 1411422Species Mouse (Mus musculus) [TaxId:10090] [188594] (2 PDB entries)
  8. 1411424Domain d2yy9a_: 2yy9 A: [207739]
    automated match to d3b84a_

Details for d2yy9a_

PDB Entry: 2yy9 (more details), 2.6 Å

PDB Description: Crystal structure of BTB domain from mouse HKR3
PDB Compounds: (A:) Zinc finger and BTB domain-containing protein 48

SCOPe Domain Sequences for d2yy9a_:

Sequence, based on SEQRES records: (download)

>d2yy9a_ d.42.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghsvrvlqelnkqrekgqycdatldvgglvfkahwsvlaccshffqriygdgtggsvvlp
agfaeifgllldffytghlaltsgnrdqvllaakelrvpeavelcqsfqp

Sequence, based on observed residues (ATOM records): (download)

>d2yy9a_ d.42.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
ghsvrvlqelnkqrekgqycdatldvgglvfkahwsvlaccshffqriyggsvvlpagfa
eifgllldffytghlaltsgnrdqvllaakelrvpeavelcqsfqp

SCOPe Domain Coordinates for d2yy9a_:

Click to download the PDB-style file with coordinates for d2yy9a_.
(The format of our PDB-style files is described here.)

Timeline for d2yy9a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2yy9b_