![]() | Class g: Small proteins [56992] (98 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) ![]() automatically mapped to Pfam PF02748 |
![]() | Family g.41.7.0: automated matches [227216] (1 protein) not a true family |
![]() | Protein automated matches [226954] (1 species) not a true protein |
![]() | Species Methanocaldococcus jannaschii [TaxId:2190] [225363] (1 PDB entry) |
![]() | Domain d2ywwa2: 2yww A:100-148 [207735] Other proteins in same PDB: d2ywwa1, d2ywwb1 automated match to d1pg5b2 complexed with atp, zn |
PDB Entry: 2yww (more details), 2 Å
SCOPe Domain Sequences for d2ywwa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ywwa2 g.41.7.0 (A:100-148) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} deiegtlkctnpncitnkekvrgkfkiesknplkircyycekflnevif
Timeline for d2ywwa2: