Lineage for d2ywwa2 (2yww A:100-148)

  1. Root: SCOPe 2.05
  2. 1959977Class g: Small proteins [56992] (92 folds)
  3. 1965821Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 1966286Superfamily g.41.7: Aspartate carbamoyltransferase, Regulatory-chain, C-terminal domain [57825] (2 families) (S)
    automatically mapped to Pfam PF02748
  5. 1966428Family g.41.7.0: automated matches [227216] (1 protein)
    not a true family
  6. 1966429Protein automated matches [226954] (1 species)
    not a true protein
  7. 1966430Species Methanocaldococcus jannaschii [TaxId:2190] [225363] (1 PDB entry)
  8. 1966431Domain d2ywwa2: 2yww A:100-148 [207735]
    Other proteins in same PDB: d2ywwa1, d2ywwb1
    automated match to d1pg5b2
    complexed with atp, zn

Details for d2ywwa2

PDB Entry: 2yww (more details), 2 Å

PDB Description: Crystal structure of aspartate carbamoyltransferase regulatory chain from Methanocaldococcus jannaschii
PDB Compounds: (A:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2ywwa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ywwa2 g.41.7.0 (A:100-148) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
deiegtlkctnpncitnkekvrgkfkiesknplkircyycekflnevif

SCOPe Domain Coordinates for d2ywwa2:

Click to download the PDB-style file with coordinates for d2ywwa2.
(The format of our PDB-style files is described here.)

Timeline for d2ywwa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ywwa1