Lineage for d2ywna_ (2ywn A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370814Species Sulfolobus tokodaii [TaxId:273063] [193434] (2 PDB entries)
  8. 1370816Domain d2ywna_: 2ywn A: [207733]
    automated match to d4g2ea_

Details for d2ywna_

PDB Entry: 2ywn (more details), 1.6 Å

PDB Description: crystal structure of peroxiredoxin-like protein from sulfolobus tokodaii
PDB Compounds: (A:) Peroxiredoxin-like protein

SCOPe Domain Sequences for d2ywna_:

Sequence, based on SEQRES records: (download)

>d2ywna_ c.47.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ghmveigelapdfelpdtelkkvklsalkgkvvvlafypaaftqvctkemctfrdsmakf
nqvnavvlgisvdppfsnkafkehnklnftilsdynrevvkkynvawefpalpgyvlakr
avfvidkegkvrykwvsddptkeppydeiekvvksls

Sequence, based on observed residues (ATOM records): (download)

>d2ywna_ c.47.1.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
ghmveigelapdfelpdtelkkvklsalkgkvvvlafypaaftqvfrdsmakfnqvnavv
lgisvdppfsnkafkehnklnftilsdynrevvkkynvawefpalpgyvlakravfvidk
egkvrykwvsddptkeppydeiekvvksls

SCOPe Domain Coordinates for d2ywna_:

Click to download the PDB-style file with coordinates for d2ywna_.
(The format of our PDB-style files is described here.)

Timeline for d2ywna_: