| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
| Protein NADH-dependent ferredoxin reductase, BphA4, N- and C-terminal domain [418950] (1 species) |
| Species Pseudomonas sp., KKS102 [TaxId:306] [419406] (9 PDB entries) |
| Domain d2yvga1: 2yvg A:6-115,A:237-308 [207730] Other proteins in same PDB: d2yvga2, d2yvga3, d2yvga4 automated match to d1d7ya1 complexed with fad, nad has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2yvg (more details), 1.6 Å
SCOPe Domain Sequences for d2yvga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvga1 c.3.1.5 (A:6-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4, N- and C-terminal domain {Pseudomonas sp., KKS102 [TaxId: 306]}
lkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgdaekir
ldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapraXvlandalar
aaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgiavarhl
vdp
Timeline for d2yvga1: