Lineage for d1mhec1 (1mhe C:182-274)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 452843Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 452844Species Human (Homo sapiens) [TaxId:9606] [88605] (70 PDB entries)
  8. 452917Domain d1mhec1: 1mhe C:182-274 [20773]
    Other proteins in same PDB: d1mhea2, d1mheb_, d1mhec2, d1mhed_

Details for d1mhec1

PDB Entry: 1mhe (more details), 2.85 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla-e
PDB Compounds: (C:)

SCOP Domain Sequences for d1mhec1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhec1 b.1.1.2 (C:182-274) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepvtlrw

SCOP Domain Coordinates for d1mhec1:

Click to download the PDB-style file with coordinates for d1mhec1.
(The format of our PDB-style files is described here.)

Timeline for d1mhec1: