SCOP 1.55: Domain d1mhec1: 1mhe C:182-274

Lineage for d1mhec1 (1mhe C:182-274)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)

7. Species Human (Homo sapiens), HLA-E [TaxId:9606] [48957] (1 PDB entry)

8. Domain d1mhec1: 1mhe C:182-274 [20773]
   Other proteins in same PDB: d1mhea2, d1mhec2

Details for d1mhec1

PDB Entry: 1mhe, 2.85 Å

PDB Description: the human non-classical major histocompatibility complex molecule hla-e

SCOP Domain Sequences for d1mhec1:

Sequence; same for both SEQRES and ATOM records:

>d1mhec1 b.1.1.2 (C:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-E}
leppkthvthhpisdheatlrcwalgfypaeitltwqqdgeghtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepvtlrw

Timeline for d1mhec1:

• d1mhec1 appears in SCOP 1.57
  
• d1mhec1 appears in the current release, SCOPe 2.08