Lineage for d2yvfa2 (2yvf A:116-236)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850123Protein NADH-dependent ferredoxin reductase, BphA4, middle domain [418951] (1 species)
  7. 2850124Species Pseudomonas sp., KKS102 [TaxId:306] [419407] (9 PDB entries)
  8. 2850126Domain d2yvfa2: 2yvf A:116-236 [207728]
    Other proteins in same PDB: d2yvfa1, d2yvfa3, d2yvfa4
    automated match to d1d7ya2
    complexed with fad, fmt, nad

Details for d2yvfa2

PDB Entry: 2yvf (more details), 1.6 Å

PDB Description: Crystal structure of ferredoxin reductase BPHA4 (hydroquinone)
PDB Compounds: (A:) Ferredoxin reductase

SCOPe Domain Sequences for d2yvfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvfa2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4, middle domain {Pseudomonas sp., KKS102 [TaxId: 306]}
lptlqgatmpvhtlrtledarriqaglrpqsrllivgggviglelaatartagvhvslve
tqprlmsraapatladfvaryhaaqgvdlrfersvtgsvdgvvllddgtriaadmvvvgi
g

SCOPe Domain Coordinates for d2yvfa2:

Click to download the PDB-style file with coordinates for d2yvfa2.
(The format of our PDB-style files is described here.)

Timeline for d2yvfa2: