Lineage for d2yvfa1 (2yvf A:6-115,A:237-308)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850135Protein NADH-dependent ferredoxin reductase, BphA4, N- and C-terminal domain [418950] (1 species)
  7. 2850136Species Pseudomonas sp., KKS102 [TaxId:306] [419406] (9 PDB entries)
  8. 2850138Domain d2yvfa1: 2yvf A:6-115,A:237-308 [207727]
    Other proteins in same PDB: d2yvfa2, d2yvfa3, d2yvfa4
    automated match to d1d7ya1
    complexed with fad, fmt, nad

    has additional insertions and/or extensions that are not grouped together

Details for d2yvfa1

PDB Entry: 2yvf (more details), 1.6 Å

PDB Description: Crystal structure of ferredoxin reductase BPHA4 (hydroquinone)
PDB Compounds: (A:) Ferredoxin reductase

SCOPe Domain Sequences for d2yvfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yvfa1 c.3.1.5 (A:6-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4, N- and C-terminal domain {Pseudomonas sp., KKS102 [TaxId: 306]}
lkapvvvlgaglasvsfvaelrqagyqglitvvgdeaerpydrpplskdfmahgdaekir
ldckrapevewllgvtaqsfdpqahtvalsdgrtlpygtlvlatgaapraXvlandalar
aaglacddgifvdaygrttcpdvyalgdvtrqrnplsgrferietwsnaqnqgiavarhl
vdp

SCOPe Domain Coordinates for d2yvfa1:

Click to download the PDB-style file with coordinates for d2yvfa1.
(The format of our PDB-style files is described here.)

Timeline for d2yvfa1: