Lineage for d2yveb2 (2yve B:75-174)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011555Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2011556Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2011557Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2011840Protein Transcriptional regulator Cgl2612 [140895] (1 species)
  7. 2011841Species Corynebacterium glutamicum [TaxId:1718] [140896] (5 PDB entries)
    Uniprot Q8NMG3 75-175
  8. 2011843Domain d2yveb2: 2yve B:75-174 [207726]
    Other proteins in same PDB: d2yvea1, d2yveb1
    automated match to d2zoya2
    complexed with cl, gol, mbt

Details for d2yveb2

PDB Entry: 2yve (more details), 1.4 Å

PDB Description: Crystal structure of the methylene blue-bound form of the multi-drug binding transcriptional repressor CgmR
PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d2yveb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yveb2 a.121.1.1 (B:75-174) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
edplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahkr
avylvqlaadglfvhdyihddvlskskrqamletilelip

SCOPe Domain Coordinates for d2yveb2:

Click to download the PDB-style file with coordinates for d2yveb2.
(The format of our PDB-style files is described here.)

Timeline for d2yveb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yveb1