Lineage for d2yveb1 (2yve B:3-74)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1257872Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1258262Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 1258495Protein Transcriptional regulator Cgl2612 [140181] (1 species)
  7. 1258496Species Corynebacterium glutamicum [TaxId:1718] [140182] (3 PDB entries)
    Uniprot Q8NMG3 1-174
  8. 1258498Domain d2yveb1: 2yve B:3-74 [207725]
    Other proteins in same PDB: d2yvea2, d2yveb2
    automated match to d2zoya1
    complexed with cl, gol, mbt

Details for d2yveb1

PDB Entry: 2yve (more details), 1.4 Å

PDB Description: Crystal structure of the methylene blue-bound form of the multi-drug binding transcriptional repressor CgmR
PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d2yveb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yveb1 a.4.1.9 (B:3-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
tskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhelladd
wdkelrditrdp

SCOPe Domain Coordinates for d2yveb1:

Click to download the PDB-style file with coordinates for d2yveb1.
(The format of our PDB-style files is described here.)

Timeline for d2yveb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yveb2