![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily) multihelical; interlocked (homo)dimer |
![]() | Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) ![]() |
![]() | Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) |
![]() | Protein Transcriptional regulator Cgl2612 [140895] (1 species) |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [140896] (5 PDB entries) Uniprot Q8NMG3 75-175 |
![]() | Domain d2yvea2: 2yve A:75-175 [207724] Other proteins in same PDB: d2yvea1, d2yveb1 automated match to d2zoya2 complexed with cl, gol, mbt |
PDB Entry: 2yve (more details), 1.4 Å
SCOPe Domain Sequences for d2yvea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvea2 a.121.1.1 (A:75-175) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} edplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahkr avylvqlaadglfvhdyihddvlskskrqamletilelips
Timeline for d2yvea2: