SCOPe 2.03: Domain d2yvea2: 2yve A:75-175

Lineage for d2yvea2 (2yve A:75-175)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Transcriptional regulator Cgl2612 [140895] (1 species)

7. Species Corynebacterium glutamicum [TaxId:1718] [140896] (3 PDB entries)
   Uniprot Q8NMG3 75-175

8. Domain d2yvea2: 2yve A:75-175 [207724]
   Other proteins in same PDB: d2yvea1, d2yveb1
   automated match to d2zoya2
   complexed with cl, gol, mbt

Details for d2yvea2

PDB Entry: 2yve, 1.4 Å

PDB Description: Crystal structure of the methylene blue-bound form of the multi-drug binding transcriptional repressor CgmR

PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2yvea2:

Sequence; same for both SEQRES and ATOM records:

>d2yvea2 a.121.1.1 (A:75-175) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
edplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahkr
avylvqlaadglfvhdyihddvlskskrqamletilelips

Timeline for d2yvea2:

• d2yvea2 is new in SCOPe 2.03-stable
  
• d2yvea2 appears in SCOPe 2.04
  
• d2yvea2 appears in the current release, SCOPe 2.08