SCOPe 2.07: Domain d2yvea1: 2yve A:1-74

Lineage for d2yvea1 (2yve A:1-74)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Transcriptional regulator Cgl2612 [140181] (1 species)

7. Species Corynebacterium glutamicum [TaxId:1718] [140182] (5 PDB entries)
   Uniprot Q8NMG3 1-174

8. Domain d2yvea1: 2yve A:1-74 [207723]
   Other proteins in same PDB: d2yvea2, d2yveb2
   automated match to d2zoya1
   complexed with cl, gol, mbt

Details for d2yvea1

PDB Entry: 2yve, 1.4 Å

PDB Description: Crystal structure of the methylene blue-bound form of the multi-drug binding transcriptional repressor CgmR

PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d2yvea1:

Sequence; same for both SEQRES and ATOM records:

>d2yvea1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
ddwdkelrditrdp

Timeline for d2yvea1:

• d2yvea1 first appeared in SCOPe 2.03
  
• d2yvea1 appears in SCOPe 2.06
  
• d2yvea1 appears in the current release, SCOPe 2.08