![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (20 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Transcriptional regulator Cgl2612 [140181] (1 species) |
![]() | Species Corynebacterium glutamicum [TaxId:1718] [140182] (3 PDB entries) Uniprot Q8NMG3 1-174 |
![]() | Domain d2yvea1: 2yve A:1-74 [207723] Other proteins in same PDB: d2yvea2, d2yveb2 automated match to d2zoya1 complexed with cl, gol, mbt |
PDB Entry: 2yve (more details), 1.4 Å
SCOPe Domain Sequences for d2yvea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yvea1 a.4.1.9 (A:1-74) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]} mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella ddwdkelrditrdp
Timeline for d2yvea1: