Lineage for d2yv2a1 (2yv2 A:9-128)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349785Family c.2.1.8: CoA-binding domain [51900] (6 proteins)
  6. 1349802Protein Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain [51901] (5 species)
  7. 1349803Species Aeropyrum pernix [TaxId:272557] [225351] (1 PDB entry)
  8. 1349804Domain d2yv2a1: 2yv2 A:9-128 [207720]
    Other proteins in same PDB: d2yv2a2
    automated match to d1euda1

Details for d2yv2a1

PDB Entry: 2yv2 (more details), 2.2 Å

PDB Description: Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Aeropyrum pernix K1
PDB Compounds: (A:) succinyl-coa synthetase alpha chain

SCOPe Domain Sequences for d2yv2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yv2a1 c.2.1.8 (A:9-128) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Aeropyrum pernix [TaxId: 272557]}
lvdsetrvlvqgitgregsfhakamleygtkvvagvtpgkggsevhgvpvydsvkealae
hpeintsivfvpapfapdavyeavdagirlvvvitegipvhdtmrfvnyarqkgatiigp

SCOPe Domain Coordinates for d2yv2a1:

Click to download the PDB-style file with coordinates for d2yv2a1.
(The format of our PDB-style files is described here.)

Timeline for d2yv2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yv2a2