Lineage for d2yv1a2 (2yv1 A:128-293)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102261Superfamily c.23.4: Succinyl-CoA synthetase domains [52210] (2 families) (S)
  5. 2102262Family c.23.4.1: Succinyl-CoA synthetase domains [52211] (3 protein domains)
    contain additional N-terminal strand "0", antiparallel to strand 2
  6. 2102269Protein Succinyl-CoA synthetase, alpha-chain, C-terminal domain [52212] (5 species)
  7. 2102297Species Methanocaldococcus jannaschii [TaxId:243232] [225350] (1 PDB entry)
  8. 2102298Domain d2yv1a2: 2yv1 A:128-293 [207719]
    Other proteins in same PDB: d2yv1a1
    automated match to d2scua2

Details for d2yv1a2

PDB Entry: 2yv1 (more details), 1.7 Å

PDB Description: Crystal Structure of Succinyl-CoA Synthetase Alpha Chain from Methanocaldococcus jannaschii DSM 2661
PDB Compounds: (A:) Succinyl-CoA ligase [ADP-forming] subunit alpha

SCOPe Domain Sequences for d2yv1a2:

Sequence, based on SEQRES records: (download)

>d2yv1a2 c.23.4.1 (A:128-293) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Methanocaldococcus jannaschii [TaxId: 243232]}
ntpgiaspkvgklgiipmevlkegsvgmvsrsgtltyeiahqikkagfgvstcvgiggdp
ivglrykevldlfekddeteaivmigeigggaeeeaakfiekmkkpvigyiagqsapegk
rmghagaivekgkgtaeskmkaleeagayvaknisdipkllagilg

Sequence, based on observed residues (ATOM records): (download)

>d2yv1a2 c.23.4.1 (A:128-293) Succinyl-CoA synthetase, alpha-chain, C-terminal domain {Methanocaldococcus jannaschii [TaxId: 243232]}
ntpgiaspkvgklgiipmevlkegsvgmvsrsgtltyeiahqikkagfgvstcvgiggdp
ivglrykevldlfekddeteaivmigeigggaeeeaakfiekmkkpvigyiagqgtaesk
mkaleeagayvaknisdipkllagilg

SCOPe Domain Coordinates for d2yv1a2:

Click to download the PDB-style file with coordinates for d2yv1a2.
(The format of our PDB-style files is described here.)

Timeline for d2yv1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2yv1a1