SCOPe 2.03: Domain d2ypvl1: 2ypv L:1-107

Lineage for d2ypvl1 (2ypv L:1-107)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (23 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (246 PDB entries)

8. Domain d2ypvl1: 2ypv L:1-107 [207715]
   Other proteins in same PDB: d2ypvl2
   automated match to d1dqdl1
   complexed with edo

Details for d2ypvl1

PDB Entry: 2ypv, 1.8 Å

PDB Description: Crystal structure of the Meningococcal vaccine antigen factor H binding protein in complex with a bactericidal antibody

PDB Compounds: (L:) fab 12c1

SCOPe Domain Sequences for d2ypvl1:

Sequence; same for both SEQRES and ATOM records:

>d2ypvl1 b.1.1.0 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspssiyaslgervtltckasqdihnylnwfqqkpgkspktliyranrlvdgvps
rfsgggsgqdysltisslefedigiyyclqydefpptfgggtrleik

Timeline for d2ypvl1:

• d2ypvl1 is new in SCOPe 2.03-stable
  
• d2ypvl1 appears in SCOPe 2.04
  
• d2ypvl1 appears in the current release, SCOPe 2.08