SCOPe 2.08: Domain d2yp8a1: 2yp8 A:8-327

Lineage for d2yp8a1 (2yp8 A:8-327)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (19 species)
   not a true protein

7. Species Influenza A virus, different strains [TaxId:11320] [187142] (19 PDB entries)

8. Domain d2yp8a1: 2yp8 A:8-327 [207706]
   automated match to d1ha0a1
   complexed with epe, nag, sia, tam

Details for d2yp8a1

PDB Entry: 2yp8, 1.8 Å

PDB Description: haemagglutinin of 2005 human h3n2 virus in complex with human receptor analogue 6sln

PDB Compounds: (A:) Hemagglutinin

SCOPe Domain Sequences for d2yp8a1:

Sequence; same for both SEQRES and ATOM records:

>d2yp8a1 b.19.1.2 (A:8-327) automated matches {Influenza A virus, different strains [TaxId: 11320]}
nstatlclghhavpngtivktitndqievtnatelvqssstggicdsphqildgenctli
dallgdpqcdgfqnkkwdlfverskaysncypydvpdyaslrslvassgtlefnnesfnw
tgvtqngtssackrksnnsffsrlnwlthlkfkypalnvtmpnnekfdklyiwgvhhpgt
dndqiflyaqasgritvstkrsqqtvipnigsrprvrnipsrisiywtivkpgdillins
tgnliaprgyfkirsgkssimrsdapigkcnsecitpngsipndkpfqnvnritygacpr
yvkqntlklatgmrnvpekq

Timeline for d2yp8a1:

• d2yp8a1 first appeared in SCOPe 2.03
  
• d2yp8a1 appears in SCOPe 2.07