Lineage for d2yohb_ (2yoh B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2113903Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2113904Protein automated matches [190123] (130 species)
    not a true protein
  7. 2114574Species Plasmodium falciparum [TaxId:36329] [193845] (8 PDB entries)
  8. 2114578Domain d2yohb_: 2yoh B: [207696]
    automated match to d3tmke_
    complexed with wmj

Details for d2yohb_

PDB Entry: 2yoh (more details), 1.6 Å

PDB Description: Plasmodium falciparum thymidylate kinase in complex with a urea-alpha- deoxythymidine inhibitor
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d2yohb_:

Sequence, based on SEQRES records: (download)

>d2yohb_ c.37.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ddkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylkme
nsmsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcmnp
dqglikpdvvfylnvppnyaqnrsdygeeiyekvetqkkiyetykhfahedywinidatr
kiedihndivkevtkikvepeefnflws

Sequence, based on observed residues (ATOM records): (download)

>d2yohb_ c.37.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ddkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylkme
nsmsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcmnp
dqglikpdvvfylnvppnyaeiyekvetqkkiyetykhfahedywinidatrkiedihnd
ivkevtkikvepeefnflws

SCOPe Domain Coordinates for d2yohb_:

Click to download the PDB-style file with coordinates for d2yohb_.
(The format of our PDB-style files is described here.)

Timeline for d2yohb_: