SCOPe 2.05: Domain d2yoga_: 2yog A:

Lineage for d2yoga_ (2yog A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (96 species)
   not a true protein

7. Species Plasmodium falciparum [TaxId:36329] [193845] (8 PDB entries)

8. Domain d2yoga_: 2yog A: [207693]
   automated match to d3tmke_
   complexed with 74x

Details for d2yoga_

PDB Entry: 2yog, 1.5 Å

PDB Description: Plasmodium falciparum thymidylate kinase in complex with a (thio)urea- alpha-deoxythymidine inhibitor

PDB Compounds: (A:) thymidylate kinase

SCOPe Domain Sequences for d2yoga_:

Sequence, based on SEQRES records:

>d2yoga_ c.37.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
dkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylkmen
smsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcmnpd
qglikpdvvfylnvppnyaqnrsdygeeiyekvetqkkiyetykhfahedywinidatrk
iedihndivkevtkikvepeefnflws

Sequence, based on observed residues (ATOM records):

>d2yoga_ c.37.1.0 (A:) automated matches {Plasmodium falciparum [TaxId: 36329]}
dkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylkmen
smsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcmnpd
qglikpdvvfylnvppnyiyekvetqkkiyetykhfahedywinidatrkiedihndivk
evtkikvepeefnflws

Timeline for d2yoga_:

• d2yoga_ first appeared in SCOPe 2.03
  
• d2yoga_ appears in SCOPe 2.04
  
• d2yoga_ appears in SCOPe 2.06
  
• d2yoga_ appears in the current release, SCOPe 2.08