| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
| Protein automated matches [190123] (158 species) not a true protein |
| Species Plasmodium falciparum [TaxId:36329] [193845] (8 PDB entries) |
| Domain d2yofc_: 2yof C: [207692] automated match to d3tmke_ complexed with 74w, act, tam |
PDB Entry: 2yof (more details), 1.82 Å
SCOPe Domain Sequences for d2yofc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yofc_ c.37.1.0 (C:) automated matches {Plasmodium falciparum [TaxId: 36329]}
ddkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylkme
nsmsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcmnp
dqglikpdvvfylnvppnyaqnrsdygeeiyekvetqkkiyetykhfahedywinidatr
kiedihndivkevtkikvepeefnflws
Timeline for d2yofc_: