Lineage for d2yofb_ (2yof B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2129025Species Plasmodium falciparum [TaxId:36329] [193845] (8 PDB entries)
  8. 2129031Domain d2yofb_: 2yof B: [207691]
    automated match to d3tmke_
    complexed with 74w, act, tam

Details for d2yofb_

PDB Entry: 2yof (more details), 1.82 Å

PDB Description: Plasmodium falciparum thymidylate kinase in complex with a (thio)urea- beta-deoxythymidine inhibitor
PDB Compounds: (B:) thymidylate kinase

SCOPe Domain Sequences for d2yofb_:

Sequence, based on SEQRES records: (download)

>d2yofb_ c.37.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mtddkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylk
mensmsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcm
npdqglikpdvvfylnvppnyaqnrsdygeeiyekvetqkkiyetykhfahedywinida
trkiedihndivkevtkikvepeefnflws

Sequence, based on observed residues (ATOM records): (download)

>d2yofb_ c.37.1.0 (B:) automated matches {Plasmodium falciparum [TaxId: 36329]}
mtddkkkgkfivfegldrsgkstqskllveylknnnvevkhlyfpnretgigqiiskylk
mensmsnetihllfsanrwehmneikslllkgiwvvcdryaysgvayssgalnlnktwcm
npdqglikpdvvfylnvppnyaqeeiyekvetqkkiyetykhfahedywinidatrkied
ihndivkevtkikvepeefnflws

SCOPe Domain Coordinates for d2yofb_:

Click to download the PDB-style file with coordinates for d2yofb_.
(The format of our PDB-style files is described here.)

Timeline for d2yofb_: