![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species) |
![]() | Species Human (Homo sapiens), HLA-CW4 [TaxId:9606] [48956] (2 PDB entries) |
![]() | Domain d1qqda1: 1qqd A:182-274 [20769] Other proteins in same PDB: d1qqda2 |
PDB Entry: 1qqd (more details), 2.7 Å
SCOP Domain Sequences for d1qqda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qqda1 b.1.1.2 (A:182-274) Class I MHC, beta2-microglobulin and alpha-3 domain {Human (Homo sapiens), HLA-CW4} aehpkthvthhpvsdheatlrcwalgfypaeitltwqwdgedqtqdtelvetrpagdgtf qkwaavvvpsgeeqrytchvqheglpepltlrw
Timeline for d1qqda1: