SCOPe 2.03: Domain d2ynvb_: 2ynv B:

Lineage for d2ynvb_ (2ynv B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (8 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187706] (5 PDB entries)

8. Domain d2ynvb_: 2ynv B: [207687]
   automated match to d1jjeb_
   complexed with mg, zn

Details for d2ynvb_

PDB Entry: 2ynv, 2.05 Å

PDB Description: cys221 oxidized, mono zinc gim-1 - gim-1-ox. crystal structures of pseudomonas aeruginosa gim-1: active site plasticity in metallo-beta- lactamases

PDB Compounds: (B:) gim-1 protein

SCOPe Domain Sequences for d2ynvb_:

Sequence; same for both SEQRES and ATOM records:

>d2ynvb_ d.157.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
kplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllswat
drgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkddeft
lgnglielyypgaghtednivawlpkskilfggclvrsheweglgyvgdasisswadsik
nivskkypiqmvvpghgkvgssdildhtidlaesasn

Timeline for d2ynvb_:

• d2ynvb_ is new in SCOPe 2.03-stable
  
• d2ynvb_ appears in SCOPe 2.04
  
• d2ynvb_ appears in the current release, SCOPe 2.08