![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (8 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [187706] (5 PDB entries) |
![]() | Domain d2ynva_: 2ynv A: [207686] automated match to d1jjeb_ complexed with mg, zn |
PDB Entry: 2ynv (more details), 2.05 Å
SCOPe Domain Sequences for d2ynva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ynva_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} kplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllswat drgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkddeft lgnglielyypgaghtednivawlpkskilfggclvrsheweglgyvgdasisswadsik nivskkypiqmvvpghgkvgssdildhtidlaesasn
Timeline for d2ynva_: