Lineage for d2ynva_ (2ynv A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440053Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1440054Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1440394Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1440395Protein automated matches [190418] (8 species)
    not a true protein
  7. 1440452Species Pseudomonas aeruginosa [TaxId:287] [187706] (5 PDB entries)
  8. 1440462Domain d2ynva_: 2ynv A: [207686]
    automated match to d1jjeb_
    complexed with mg, zn

Details for d2ynva_

PDB Entry: 2ynv (more details), 2.05 Å

PDB Description: cys221 oxidized, mono zinc gim-1 - gim-1-ox. crystal structures of pseudomonas aeruginosa gim-1: active site plasticity in metallo-beta- lactamases
PDB Compounds: (A:) gim-1 protein

SCOPe Domain Sequences for d2ynva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ynva_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
kplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllswat
drgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkddeft
lgnglielyypgaghtednivawlpkskilfggclvrsheweglgyvgdasisswadsik
nivskkypiqmvvpghgkvgssdildhtidlaesasn

SCOPe Domain Coordinates for d2ynva_:

Click to download the PDB-style file with coordinates for d2ynva_.
(The format of our PDB-style files is described here.)

Timeline for d2ynva_: