Lineage for d2ynua_ (2ynu A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440053Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1440054Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1440394Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1440395Protein automated matches [190418] (8 species)
    not a true protein
  7. 1440452Species Pseudomonas aeruginosa [TaxId:287] [187706] (5 PDB entries)
  8. 1440460Domain d2ynua_: 2ynu A: [207684]
    automated match to d1jjeb_

Details for d2ynua_

PDB Entry: 2ynu (more details), 2.06 Å

PDB Description: Apo GIM-1 with 2Mol. Crystal structures of Pseudomonas aeruginosa GIM-1: active site plasticity in metallo-beta-lactamases
PDB Compounds: (A:) gim-1 protein

SCOPe Domain Sequences for d2ynua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ynua_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
kplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllswat
drgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkddeft
lgnglielyypgaghtednivawlpkskilfggclvrsheweglgyvgdasisswadsik
nivskkypiqmvvpghgkvgssdildhtidlaesasn

SCOPe Domain Coordinates for d2ynua_:

Click to download the PDB-style file with coordinates for d2ynua_.
(The format of our PDB-style files is described here.)

Timeline for d2ynua_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ynub_