| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
| Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
| Protein automated matches [190418] (31 species) not a true protein |
| Species Pseudomonas aeruginosa [TaxId:287] [187706] (20 PDB entries) |
| Domain d2ynua_: 2ynu A: [207684] automated match to d1jjeb_ |
PDB Entry: 2ynu (more details), 2.06 Å
SCOPe Domain Sequences for d2ynua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ynua_ d.157.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
kplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllswat
drgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkddeft
lgnglielyypgaghtednivawlpkskilfggclvrsheweglgyvgdasisswadsik
nivskkypiqmvvpghgkvgssdildhtidlaesasn
Timeline for d2ynua_: