SCOPe 2.05: Domain d2yntb_: 2ynt B:

Lineage for d2yntb_ (2ynt B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
   duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets

4. Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families)

5. Family d.157.1.0: automated matches [191360] (1 protein)
   not a true family

6. Protein automated matches [190418] (15 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [187706] (10 PDB entries)

8. Domain d2yntb_: 2ynt B: [207682]
   automated match to d1jjeb_
   complexed with gol, zn

Details for d2yntb_

PDB Entry: 2ynt, 1.6 Å

PDB Description: GIM-1-3Mol native. Crystal structures of Pseudomonas aeruginosa GIM- 1: active site plasticity in metallo-beta-lactamases

PDB Compounds: (B:) gim-1 protein

SCOPe Domain Sequences for d2yntb_:

Sequence; same for both SEQRES and ATOM records:

>d2yntb_ d.157.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
hkplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtklllswa
tdrgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkddef
tlgnglielyypgaghtednivawlpkskilfggclvrshewealgyvgdasisswadsi
knivskkypiqmvvpghgkvgssdildhtidlaesasnk

Timeline for d2yntb_:

• d2yntb_ first appeared in SCOPe 2.03
  
• d2yntb_ appears in SCOPe 2.04
  
• d2yntb_ appears in SCOPe 2.06
  
• d2yntb_ appears in the current release, SCOPe 2.08