Lineage for d2ynta1 (2ynt A:37-295)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603852Species Pseudomonas aeruginosa [TaxId:287] [187706] (20 PDB entries)
  8. 2603857Domain d2ynta1: 2ynt A:37-295 [207681]
    Other proteins in same PDB: d2ynta2
    automated match to d1jjeb_
    complexed with gol, zn

Details for d2ynta1

PDB Entry: 2ynt (more details), 1.6 Å

PDB Description: GIM-1-3Mol native. Crystal structures of Pseudomonas aeruginosa GIM- 1: active site plasticity in metallo-beta-lactamases
PDB Compounds: (A:) gim-1 protein

SCOPe Domain Sequences for d2ynta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ynta1 d.157.1.0 (A:37-295) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
qghkplevikiedgvylhtsfkniegyglvdsnglvvldnnqayiidtpwseedtkllls
watdrgyqvmasisthshedrtagikllnsksiptytseltkkllaregkpvpthyfkdd
eftlgnglielyypgaghtednivawlpkskilfggclvrsheweglgyvgdasisswad
siknivskkypiqmvvpghgkvgssdildhtidlaesasn

SCOPe Domain Coordinates for d2ynta1:

Click to download the PDB-style file with coordinates for d2ynta1.
(The format of our PDB-style files is described here.)

Timeline for d2ynta1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ynta2