Lineage for d2ynha2 (2ynh A:430-558)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887284Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)
  8. 2887301Domain d2ynha2: 2ynh A:430-558 [207676]
    Other proteins in same PDB: d2ynha1, d2ynha3, d2ynhb_
    automated match to d1bqna1
    complexed with eur, tar

Details for d2ynha2

PDB Entry: 2ynh (more details), 2.9 Å

PDB Description: HIV-1 Reverse Transcriptase in complex with inhibitor GSK500
PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2ynha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ynha2 c.55.3.0 (A:430-558) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

SCOPe Domain Coordinates for d2ynha2:

Click to download the PDB-style file with coordinates for d2ynha2.
(The format of our PDB-style files is described here.)

Timeline for d2ynha2:

View in 3D
Domains from other chains:
(mouse over for more information)
d2ynhb_