SCOPe 2.03: Domain d2ynga2: 2yng A:430-558

Lineage for d2ynga2 (2yng A:430-558)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (20 species)
   not a true protein

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [225268] (21 PDB entries)

8. Domain d2ynga2: 2yng A:430-558 [207673]
   Other proteins in same PDB: d2ynga1, d2yngb_
   automated match to d1bqna1
   complexed with mg, srt, whu; mutant

Details for d2ynga2

PDB Entry: 2yng, 2.12 Å

PDB Description: HIV-1 Reverse Transcriptase in complex with inhibitor GSK560

PDB Compounds: (A:) Reverse transcriptase/ribonuclease H

SCOPe Domain Sequences for d2ynga2:

Sequence; same for both SEQRES and ATOM records:

>d2ynga2 c.55.3.0 (A:430-558) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
ekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylalqds
glevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgiggneqvd
klvsagirk

Timeline for d2ynga2:

• d2ynga2 is new in SCOPe 2.03-stable
  
• d2ynga2 appears in SCOPe 2.04
  
• d2ynga2 appears in the current release, SCOPe 2.08