Lineage for d1efxa1 (1efx A:182-278)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654538Species Human (Homo sapiens) [TaxId:9606] [88605] (130 PDB entries)
  8. 654709Domain d1efxa1: 1efx A:182-278 [20767]
    Other proteins in same PDB: d1efxa2, d1efxb_, d1efxd1, d1efxd2, d1efxe1, d1efxe2

Details for d1efxa1

PDB Entry: 1efx (more details), 3 Å

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3
PDB Compounds: (A:) hla-cw3 (heavy chain)

SCOP Domain Sequences for d1efxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efxa1 b.1.1.2 (A:182-278) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
aehpkthvthhpvsdheatlrcwalgfypaeitltwqwdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepltlrwepss

SCOP Domain Coordinates for d1efxa1:

Click to download the PDB-style file with coordinates for d1efxa1.
(The format of our PDB-style files is described here.)

Timeline for d1efxa1: