Lineage for d1efxa1 (1efx A:182-278)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 364612Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 364613Species Human (Homo sapiens) [TaxId:9606] [88605] (65 PDB entries)
  8. 364696Domain d1efxa1: 1efx A:182-278 [20767]
    Other proteins in same PDB: d1efxa2, d1efxb_, d1efxd1, d1efxd2, d1efxe1, d1efxe2

Details for d1efxa1

PDB Entry: 1efx (more details), 3 Å

PDB Description: structure of a complex between the human natural killer cell receptor kir2dl2 and a class i mhc ligand hla-cw3

SCOP Domain Sequences for d1efxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1efxa1 b.1.1.2 (A:182-278) Class I MHC, alpha-3 domain {Human (Homo sapiens)}
aehpkthvthhpvsdheatlrcwalgfypaeitltwqwdgedqtqdtelvetrpagdgtf
qkwaavvvpsgeeqrytchvqheglpepltlrwepss

SCOP Domain Coordinates for d1efxa1:

Click to download the PDB-style file with coordinates for d1efxa1.
(The format of our PDB-style files is described here.)

Timeline for d1efxa1: