Lineage for d2ylta2 (2ylt A:155-389)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1581823Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 1581824Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 1582330Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 1582574Protein Phenylacetone monooxygenase [110440] (1 species)
  7. 1582575Species Thermobifida fusca [TaxId:2021] [110441] (6 PDB entries)
    Uniprot Q5YS95 # 55% sequence identity; Nocardia farcinica TaxID:37329
  8. 1582587Domain d2ylta2: 2ylt A:155-389 [207668]
    automated match to d1w4xa2
    complexed with fad, mes, nap

Details for d2ylta2

PDB Entry: 2ylt (more details), 2.65 Å

PDB Description: snapshots of enzymatic baeyer-villiger catalysis: oxygen activation and intermediate stabilization: complex with nadp and mes
PDB Compounds: (A:) phenylacetone monooxygenase

SCOPe Domain Sequences for d2ylta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ylta2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]}
vpqlpnfpglkdfagnlyhtgnwphepvdfsgqrvgvigtgssgiqvspqiakqaaelfv
fqrtphfavparnapldpefladlkkryaefreesrntpggthryqgpksalevsdeelv
etlerywqeggpdilaayrdilrdrdanervaefirnkirntvrdpevaerlvpkgypfg
tkrlileidyyemfnrdnvhlvdtlsapietitprgvrtsereyeldslvlatgf

SCOPe Domain Coordinates for d2ylta2:

Click to download the PDB-style file with coordinates for d2ylta2.
(The format of our PDB-style files is described here.)

Timeline for d2ylta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ylta1