![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
![]() | Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (8 families) ![]() |
![]() | Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (15 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
![]() | Protein Phenylacetone monooxygenase [110440] (1 species) |
![]() | Species Thermobifida fusca [TaxId:2021] [110441] (5 PDB entries) Uniprot Q5YS95 # 55% sequence identity; Nocardia farcinica TaxID:37329 |
![]() | Domain d2ylsa2: 2yls A:155-389 [207666] automated match to d1w4xa2 complexed with fad, nap |
PDB Entry: 2yls (more details), 2.26 Å
SCOPe Domain Sequences for d2ylsa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ylsa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} vpqlpnfpglkdfagnlyhtgnwphepvdfsgqrvgvigtgssgiqvspqiakqaaelfv fqrtphfavparnapldpefladlkkryaefreesrntpggthryqgpksalevsdeelv etlerywqeggpdilaayrdilrdrdanervaefirnkirntvrdpevaerlvpkgypfg tkrlileidyyemfnrdnvhlvdtlsapietitprgvrtsereyeldslvlatgf
Timeline for d2ylsa2: