Lineage for d2ykll2 (2ykl L:108-208)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750879Domain d2ykll2: 2ykl L:108-208 [207656]
    Other proteins in same PDB: d2ykll1
    automated match to d1aqkl2
    complexed with nld

Details for d2ykll2

PDB Entry: 2ykl (more details), 2.1 Å

PDB Description: structure of human anti-nicotine fab fragment in complex with nicotine-11-yl-methyl-(4-ethylamino-4-oxo)-butanoate
PDB Compounds: (L:) Fab fragment, light chain

SCOPe Domain Sequences for d2ykll2:

Sequence, based on SEQRES records: (download)

>d2ykll2 b.1.1.2 (L:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvap

Sequence, based on observed residues (ATOM records): (download)

>d2ykll2 b.1.1.2 (L:108-208) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkaapsvtlfppssatlvclisdfypgavtvawkadsspgvetttpskqsnnkyaassy
lsltpeqwkshrsyscqvthegstvektvap

SCOPe Domain Coordinates for d2ykll2:

Click to download the PDB-style file with coordinates for d2ykll2.
(The format of our PDB-style files is described here.)

Timeline for d2ykll2: