Lineage for d2ykll1 (2ykl L:4-107)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1765207Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)
  8. 1765539Domain d2ykll1: 2ykl L:4-107 [207655]
    Other proteins in same PDB: d2ykll2
    automated match to d1aqkl1
    complexed with nld

Details for d2ykll1

PDB Entry: 2ykl (more details), 2.1 Å

PDB Description: structure of human anti-nicotine fab fragment in complex with nicotine-11-yl-methyl-(4-ethylamino-4-oxo)-butanoate
PDB Compounds: (L:) Fab fragment, light chain

SCOPe Domain Sequences for d2ykll1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ykll1 b.1.1.0 (L:4-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltqppsasgtpgqrvtiscsgsssnigsnyvywyqqlpgtapklliyrnnqrpsgvpdr
fsgsksgtsaslaisglrsedeadyycaawddslsawvfgggtqldilg

SCOPe Domain Coordinates for d2ykll1:

Click to download the PDB-style file with coordinates for d2ykll1.
(The format of our PDB-style files is described here.)

Timeline for d2ykll1: