Lineage for d2yjkh_ (2yjk H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704263Species Microbacterium arborescens [TaxId:33883] [226147] (2 PDB entries)
  8. 2704271Domain d2yjkh_: 2yjk H: [207648]
    automated match to d1vele_
    complexed with fe, ofe

Details for d2yjkh_

PDB Entry: 2yjk (more details), 2 Å

PDB Description: structure of dps from microbacterium arborescens in the high iron form
PDB Compounds: (H:) afp

SCOPe Domain Sequences for d2yjkh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjkh_ a.25.1.0 (H:) automated matches {Microbacterium arborescens [TaxId: 33883]}
altadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdya
dtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidg
ldevdltsqdvaieikrgvdkdrwfllahlae

SCOPe Domain Coordinates for d2yjkh_:

Click to download the PDB-style file with coordinates for d2yjkh_.
(The format of our PDB-style files is described here.)

Timeline for d2yjkh_: