| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Microbacterium arborescens [TaxId:33883] [226147] (2 PDB entries) |
| Domain d2yjkd_: 2yjk D: [207644] automated match to d1vele_ complexed with fe, ofe |
PDB Entry: 2yjk (more details), 2 Å
SCOPe Domain Sequences for d2yjkd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yjkd_ a.25.1.0 (D:) automated matches {Microbacterium arborescens [TaxId: 33883]}
altadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdya
dtaaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidg
ldevdltsqdvaieikrgvdkdrwfllahlae
Timeline for d2yjkd_: