Lineage for d2yjjl_ (2yjj L:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1486323Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1486324Protein automated matches [190036] (29 species)
    not a true protein
  7. 1486398Species Microbacterium arborescens [TaxId:33883] [226147] (2 PDB entries)
  8. 1486422Domain d2yjjl_: 2yjj L: [207640]
    automated match to d1vele_
    complexed with fe, ofe

Details for d2yjjl_

PDB Entry: 2yjj (more details), 2.05 Å

PDB Description: structure of dps from microbacterium arborescens in the low iron form
PDB Compounds: (L:) afp

SCOPe Domain Sequences for d2yjjl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjjl_ a.25.1.0 (L:) automated matches {Microbacterium arborescens [TaxId: 33883]}
tadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadt
aaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgld
evdltsqdvaieikrgvdkdrwfllahlae

SCOPe Domain Coordinates for d2yjjl_:

Click to download the PDB-style file with coordinates for d2yjjl_.
(The format of our PDB-style files is described here.)

Timeline for d2yjjl_: