Lineage for d2yjjf_ (2yjj F:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704263Species Microbacterium arborescens [TaxId:33883] [226147] (2 PDB entries)
  8. 2704281Domain d2yjjf_: 2yjj F: [207634]
    automated match to d1vele_
    complexed with fe, ofe

Details for d2yjjf_

PDB Entry: 2yjj (more details), 2.05 Å

PDB Description: structure of dps from microbacterium arborescens in the low iron form
PDB Compounds: (F:) afp

SCOPe Domain Sequences for d2yjjf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yjjf_ a.25.1.0 (F:) automated matches {Microbacterium arborescens [TaxId: 33883]}
tadpevaaaaaqfltpvvhkmqalvvngkqahwnvrgsnfiaihelldsvvahaqdyadt
aaerivalglpidsrvstmaektstavpagfaqwqdeikaivsdidaalvdlqaaidgld
evdltsqdvaieikrgvdkdrwfllahlae

SCOPe Domain Coordinates for d2yjjf_:

Click to download the PDB-style file with coordinates for d2yjjf_.
(The format of our PDB-style files is described here.)

Timeline for d2yjjf_: