| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
| Family d.3.1.0: automated matches [191342] (1 protein) not a true family |
| Protein automated matches [190230] (23 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187072] (53 PDB entries) |
| Domain d2yjba_: 2yjb A: [207627] automated match to d3hd3b_ complexed with gol, yj9 |
PDB Entry: 2yjb (more details), 1.4 Å
SCOPe Domain Sequences for d2yjba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yjba_ d.3.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aprsvdwrekgyvtpvknqgqcgscwafsatgalegqmfrktgrlislseqnlvdcsgpq
gnegcngglmdyafqyvqdnggldseesypyeateesckynpkysvandtgfvdipkqek
almkavatvgpisvaidaghesflfykegiyfepdcssedmdhgvlvvgygfestesdnn
kywlvknswgeewgmggyvkmakdrrnhcgiasaasyptv
Timeline for d2yjba_: